Product Added to your Cart
x

-------- OR --------

EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Spain Spain Russia Russia Portugal Portugal France France Germany Germany
0,00 €
CD
Card Sleeve Digipack Jewel Case
Joel Fausto & Illusion Orchestra - Inside The Throat Of A ..
Joel Fausto & Illusion Orchestra - Inside The Throat Of A ..
10,00 €
Joel Fausto & Illusion Orchestra - Meet Me In The Bottom
Joel Fausto & Illusion Orchestra - Meet Me In The Bottom
10,00 €
Manos - Fui Ao Céu e Voltei
Manos - Fui Ao Céu e Voltei
5,00 €
O Sol Que Nos Consome - Opróbrio - CD
O Sol Que Nos Consome - Opróbrio - CD
10,00 €
Omitir - Cotard
Omitir - Cotard
10,00 €
Omitir - Ode
Omitir - Ode
10,00 €
Omitir - Tese Em Erro
Omitir - Tese Em Erro
10,00 €
Spiritwood
Spiritwood " The Apparition Of Horns" CD
10,00 €
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i